Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA003908-25
- Shipping:
- Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Product Description
Protein Description: SRY (sex determining region Y)-box 6
Gene Name: SOX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051910: 97%, ENSRNOG00000020514: 95%
Entrez Gene ID: 55553
Uniprot ID: P35712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SOX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051910: 97%, ENSRNOG00000020514: 95%
Entrez Gene ID: 55553
Uniprot ID: P35712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ |
Gene Sequence | QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ |
Gene ID - Mouse | ENSMUSG00000051910 |
Gene ID - Rat | ENSRNOG00000020514 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) | |
Datasheet | Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) | |
Datasheet | Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) |
Citations
Citations for Anti SOX6 pAb (ATL-HPA003908 w/enhanced validation) – 3 Found |
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
Yeung, Fan; Chung, Eunhee; Guess, Martin G; Bell, Matthew L; Leinwand, Leslie A. Myh7b/miR-499 gene expression is transcriptionally regulated by MRFs and Eos. Nucleic Acids Research. 2012;40(15):7303-18. PubMed |
Marchetto, Aruna; Ohmura, Shunya; Orth, Martin F; Knott, Maximilian M L; Colombo, Maria V; Arrigoni, Chiara; Bardinet, Victor; Saucier, David; Wehweck, Fabienne S; Li, Jing; Stein, Stefanie; Gerke, Julia S; Baldauf, Michaela C; Musa, Julian; Dallmayer, Marlene; Romero-Pérez, Laura; Hölting, Tilman L B; Amatruda, James F; Cossarizza, Andrea; Henssen, Anton G; Kirchner, Thomas; Moretti, Matteo; Cidre-Aranaz, Florencia; Sannino, Giuseppina; Grünewald, Thomas G P. Oncogenic hijacking of a developmental transcription factor evokes vulnerability toward oxidative stress in Ewing sarcoma. Nature Communications. 2020;11(1):2423. PubMed |