Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation)

Catalog No:
ATL-HPA001923-25
$360.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: SRY (sex determining region Y)-box 6
Gene Name: SOX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051910: 96%, ENSRNOG00000020514: 96%
Entrez Gene ID: 55553
Uniprot ID: P35712
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS

Documents & Links for Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation)
Datasheet Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation) at Atlas

Documents & Links for Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation)
Datasheet Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation)

Citations for Anti SOX6 pAb (ATL-HPA001923 w/enhanced validation) – 6 Found
Panda, Sanjeet; Dohare, Preeti; Jain, Samhita; Parikh, Nirzar; Singla, Pranav; Mehdizadeh, Rana; Klebe, Damon W; Kleinman, George M; Cheng, Bokun; Ballabh, Praveen. Estrogen Treatment Reverses Prematurity-Induced Disruption in Cortical Interneuron Population. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2018;38(34):7378-7391.  PubMed
Herlofsen, Sarah Roxana; Küchler, Axel M; Melvik, Jan Egil; Brinchmann, Jan E. Chondrogenic differentiation of human bone marrow-derived mesenchymal stem cells in self-gelling alginate discs reveals novel chondrogenic signature gene clusters. Tissue Engineering. Part A. 2011;17(7-8):1003-13.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Fernandes, Amilton M; Herlofsen, Sarah R; Karlsen, Tommy A; Küchler, Axel M; Fløisand, Yngvar; Brinchmann, Jan E. Similar properties of chondrocytes from osteoarthritis joints and mesenchymal stem cells from healthy donors for tissue engineering of articular cartilage. Plos One. 8(5):e62994.  PubMed
Tibrewal, Mahima; Cheng, Bokun; Dohare, Preeti; Hu, Furong; Mehdizadeh, Rana; Wang, Ping; Zheng, Deyou; Ungvari, Zoltan; Ballabh, Praveen. Disruption of Interneuron Neurogenesis in Premature Newborns and Reversal with Estrogen Treatment. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2018;38(5):1100-1113.  PubMed
Pereira Luppi, Milagros; Azcorra, Maite; Caronia-Brown, Giuliana; Poulin, Jean-Francois; Gaertner, Zachary; Gatica, Serafin; Moreno-Ramos, Oscar Andrés; Nouri, Navid; Dubois, Marilyn; Ma, Yongchao C; Ramakrishnan, Charu; Fenno, Lief; Kim, Yoon Seok; Deisseroth, Karl; Cicchetti, Francesca; Dombeck, Daniel A; Awatramani, Rajeshwar. Sox6 expression distinguishes dorsally and ventrally biased dopamine neurons in the substantia nigra with distinctive properties and embryonic origins. Cell Reports. 2021;37(6):109975.  PubMed