Anti SORBS2 pAb (ATL-HPA036755)

Atlas Antibodies

SKU:
ATL-HPA036755-25
  • Immunohistochemical staining of human heart muscle shows strong nuclear and moderate cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sorbin and SH3 domain containing 2
Gene Name: SORBS2
Alternative Gene Name: ARGBP2, KIAA0777
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031626: 78%, ENSRNOG00000013391: 77%
Entrez Gene ID: 8470
Uniprot ID: O94875
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER
Gene Sequence PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER
Gene ID - Mouse ENSMUSG00000031626
Gene ID - Rat ENSRNOG00000013391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SORBS2 pAb (ATL-HPA036755)
Datasheet Anti SORBS2 pAb (ATL-HPA036755) Datasheet (External Link)
Vendor Page Anti SORBS2 pAb (ATL-HPA036755) at Atlas Antibodies

Documents & Links for Anti SORBS2 pAb (ATL-HPA036755)
Datasheet Anti SORBS2 pAb (ATL-HPA036755) Datasheet (External Link)
Vendor Page Anti SORBS2 pAb (ATL-HPA036755)