Anti SNX5 pAb (ATL-HPA051187)

Atlas Antibodies

SKU:
ATL-HPA051187-25
  • Immunohistochemical staining of human thyroid gland shows moderate cytoplasmiuc positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sorting nexin 5
Gene Name: SNX5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027423: 99%, ENSRNOG00000006077: 99%
Entrez Gene ID: 27131
Uniprot ID: Q9Y5X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRV
Gene Sequence FFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRV
Gene ID - Mouse ENSMUSG00000027423
Gene ID - Rat ENSRNOG00000006077
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SNX5 pAb (ATL-HPA051187)
Datasheet Anti SNX5 pAb (ATL-HPA051187) Datasheet (External Link)
Vendor Page Anti SNX5 pAb (ATL-HPA051187) at Atlas Antibodies

Documents & Links for Anti SNX5 pAb (ATL-HPA051187)
Datasheet Anti SNX5 pAb (ATL-HPA051187) Datasheet (External Link)
Vendor Page Anti SNX5 pAb (ATL-HPA051187)