Protein Description: sorting nexin 24
Gene Name: SNX24
Alternative Gene Name: SBBI31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024535: 95%, ENSRNOG00000017488: 95%
Entrez Gene ID: 28966
Uniprot ID: Q9Y343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNX24
Alternative Gene Name: SBBI31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024535: 95%, ENSRNOG00000017488: 95%
Entrez Gene ID: 28966
Uniprot ID: Q9Y343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHA |
| Documents & Links for Anti SNX24 pAb (ATL-HPA073934) | |
| Datasheet | Anti SNX24 pAb (ATL-HPA073934) Datasheet (External Link) |
| Vendor Page | Anti SNX24 pAb (ATL-HPA073934) at Atlas |
| Documents & Links for Anti SNX24 pAb (ATL-HPA073934) | |
| Datasheet | Anti SNX24 pAb (ATL-HPA073934) Datasheet (External Link) |
| Vendor Page | Anti SNX24 pAb (ATL-HPA073934) |