Protein Description: SNRPN upstream reading frame
Gene Name: SNURF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102627: 97%, ENSRNOG00000054391: 94%
Entrez Gene ID: 8926
Uniprot ID: Q9Y675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNURF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102627: 97%, ENSRNOG00000054391: 94%
Entrez Gene ID: 8926
Uniprot ID: Q9Y675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRS |
| Documents & Links for Anti SNURF pAb (ATL-HPA065733) | |
| Datasheet | Anti SNURF pAb (ATL-HPA065733) Datasheet (External Link) |
| Vendor Page | Anti SNURF pAb (ATL-HPA065733) at Atlas |
| Documents & Links for Anti SNURF pAb (ATL-HPA065733) | |
| Datasheet | Anti SNURF pAb (ATL-HPA065733) Datasheet (External Link) |
| Vendor Page | Anti SNURF pAb (ATL-HPA065733) |