Anti SNRPG pAb (ATL-HPA064152)
Atlas Antibodies
- SKU:
- ATL-HPA064152-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SNRPG
Alternative Gene Name: Sm-G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049124: 100%, ENSRNOG00000032232: 100%
Entrez Gene ID: 6637
Uniprot ID: P62308
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RHVQGILRGFDPFMNLVIDECVEMATSGQQ |
Gene Sequence | RHVQGILRGFDPFMNLVIDECVEMATSGQQ |
Gene ID - Mouse | ENSMUSG00000049124 |
Gene ID - Rat | ENSRNOG00000032232 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SNRPG pAb (ATL-HPA064152) | |
Datasheet | Anti SNRPG pAb (ATL-HPA064152) Datasheet (External Link) |
Vendor Page | Anti SNRPG pAb (ATL-HPA064152) at Atlas Antibodies |
Documents & Links for Anti SNRPG pAb (ATL-HPA064152) | |
Datasheet | Anti SNRPG pAb (ATL-HPA064152) Datasheet (External Link) |
Vendor Page | Anti SNRPG pAb (ATL-HPA064152) |