Anti SNRPC pAb (ATL-HPA055490)

Atlas Antibodies

SKU: ATL-HPA055490-25

• 
• 
• 

Protein Description: small nuclear ribonucleoprotein polypeptide C
Gene Name: SNRPC
Alternative Gene Name: U1-C, Yhc1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024217: 98%, ENSRNOG00000000493: 98%
Entrez Gene ID: 6631
Uniprot ID: P09234
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP
• Gene Sequence: VKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP
• Gene ID - Mouse: ENSMUSG00000024217
• Gene ID - Rat: ENSRNOG00000000493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.