Anti SNRPA pAb (ATL-HPA046440)

Atlas Antibodies

SKU: ATL-HPA046440-25

• 
• 

Protein Description: small nuclear ribonucleoprotein polypeptide A
Gene Name: SNRPA
Alternative Gene Name: Mud1, U1-A, U1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061479: 92%, ENSRNOG00000001501: 95%
Entrez Gene ID: 6626
Uniprot ID: P09012
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
• Gene Sequence: IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
• Gene ID - Mouse: ENSMUSG00000061479
• Gene ID - Rat: ENSRNOG00000001501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.