Anti SNPH pAb (ATL-HPA049393)

Atlas Antibodies

SKU: ATL-HPA049393-25

• 

Protein Description: syntaphilin
Gene Name: SNPH
Alternative Gene Name: bA314N13.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027457: 84%, ENSRNOG00000009588: 81%
Entrez Gene ID: 9751
Uniprot ID: O15079
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVV
• Gene Sequence: FPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVV
• Gene ID - Mouse: ENSMUSG00000027457
• Gene ID - Rat: ENSRNOG00000009588
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNPH pAb (ATL-HPA049393) – 2 Found

Caino, M Cecilia; Seo, Jae Ho; Aguinaldo, Angeline; Wait, Eric; Bryant, Kelly G; Kossenkov, Andrew V; Hayden, James E; Vaira, Valentina; Morotti, Annamaria; Ferrero, Stefano; Bosari, Silvano; Gabrilovich, Dmitry I; Languino, Lucia R; Cohen, Andrew R; Altieri, Dario C. A neuronal network of mitochondrial dynamics regulates metastasis. Nature Communications. 2016;7( 27991488):13730. 

Hwang, Michael J; Bryant, Kelly G; Seo, Jae H; Liu, Qin; Humphrey, Peter A; Melnick, Mary Ann C; Altieri, Dario C; Robert, Marie E. Syntaphilin Is a Novel Biphasic Biomarker of Aggressive Prostate Cancer and a Metastasis Predictor. The American Journal Of Pathology. 2019;189(6):1180-1189.