Anti SNF8 pAb (ATL-HPA059320)

Atlas Antibodies

SKU:
ATL-HPA059320-25
  • Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: SNF8, ESCRT-II complex subunit
Gene Name: SNF8
Alternative Gene Name: Dot3, EAP30, VPS22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006058: 100%, ENSRNOG00000006500: 100%
Entrez Gene ID: 11267
Uniprot ID: Q96H20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL
Gene Sequence WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL
Gene ID - Mouse ENSMUSG00000006058
Gene ID - Rat ENSRNOG00000006500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SNF8 pAb (ATL-HPA059320)
Datasheet Anti SNF8 pAb (ATL-HPA059320) Datasheet (External Link)
Vendor Page Anti SNF8 pAb (ATL-HPA059320) at Atlas Antibodies

Documents & Links for Anti SNF8 pAb (ATL-HPA059320)
Datasheet Anti SNF8 pAb (ATL-HPA059320) Datasheet (External Link)
Vendor Page Anti SNF8 pAb (ATL-HPA059320)