Anti SNF8 pAb (ATL-HPA059320)
Atlas Antibodies
- SKU:
- ATL-HPA059320-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: SNF8, ESCRT-II complex subunit
Gene Name: SNF8
Alternative Gene Name: Dot3, EAP30, VPS22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006058: 100%, ENSRNOG00000006500: 100%
Entrez Gene ID: 11267
Uniprot ID: Q96H20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNF8
Alternative Gene Name: Dot3, EAP30, VPS22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006058: 100%, ENSRNOG00000006500: 100%
Entrez Gene ID: 11267
Uniprot ID: Q96H20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL |
Gene Sequence | WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL |
Gene ID - Mouse | ENSMUSG00000006058 |
Gene ID - Rat | ENSRNOG00000006500 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SNF8 pAb (ATL-HPA059320) | |
Datasheet | Anti SNF8 pAb (ATL-HPA059320) Datasheet (External Link) |
Vendor Page | Anti SNF8 pAb (ATL-HPA059320) at Atlas Antibodies |
Documents & Links for Anti SNF8 pAb (ATL-HPA059320) | |
Datasheet | Anti SNF8 pAb (ATL-HPA059320) Datasheet (External Link) |
Vendor Page | Anti SNF8 pAb (ATL-HPA059320) |