Anti SNCA pAb (ATL-HPA005459 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005459-25

• 
• 

Protein Description: synuclein, alpha (non A4 component of amyloid precursor)
Gene Name: SNCA
Alternative Gene Name: alpha-synuclein, NACP, PARK1, PARK4, PD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025889: 93%, ENSRNOG00000008656: 93%
Entrez Gene ID: 6622
Uniprot ID: P37840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
• Gene Sequence: EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
• Gene ID - Mouse: ENSMUSG00000025889
• Gene ID - Rat: ENSRNOG00000008656
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.