Anti SNAPIN pAb (ATL-HPA046974)

Atlas Antibodies

SKU:
ATL-HPA046974-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SNAP-associated protein
Gene Name: SNAPIN
Alternative Gene Name: BLOC1S7, SNAPAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001018: 99%, ENSRNOG00000013356: 99%
Entrez Gene ID: 23557
Uniprot ID: O95295
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYP
Gene Sequence LDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYP
Gene ID - Mouse ENSMUSG00000001018
Gene ID - Rat ENSRNOG00000013356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SNAPIN pAb (ATL-HPA046974)
Datasheet Anti SNAPIN pAb (ATL-HPA046974) Datasheet (External Link)
Vendor Page Anti SNAPIN pAb (ATL-HPA046974) at Atlas Antibodies

Documents & Links for Anti SNAPIN pAb (ATL-HPA046974)
Datasheet Anti SNAPIN pAb (ATL-HPA046974) Datasheet (External Link)
Vendor Page Anti SNAPIN pAb (ATL-HPA046974)