Anti SMYD3 pAb (ATL-HPA054352)

Atlas Antibodies

SKU: ATL-HPA054352-25

• 
• 

Protein Description: SET and MYND domain containing 3
Gene Name: SMYD3
Alternative Gene Name: KMT3E, ZMYND1, ZNFN3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055067: 96%, ENSRNOG00000003583: 35%
Entrez Gene ID: 64754
Uniprot ID: Q9H7B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVR
• Gene Sequence: GELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVR
• Gene ID - Mouse: ENSMUSG00000055067
• Gene ID - Rat: ENSRNOG00000003583
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.