Anti SMPD4 pAb (ATL-HPA046279)

Atlas Antibodies

SKU: ATL-HPA046279-25

• 

Protein Description: sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3)
Gene Name: SMPD4
Alternative Gene Name: FLJ20297, FLJ20756, KIAA1418, NET13, nSMase-3, NSMASE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005899: 92%, ENSRNOG00000001875: 94%
Entrez Gene ID: 55627
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASLKADSINKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSY
• Gene Sequence: ASLKADSINKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSY
• Gene ID - Mouse: ENSMUSG00000005899
• Gene ID - Rat: ENSRNOG00000001875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.