Anti SMOX pAb (ATL-HPA060198)
Atlas Antibodies
- SKU:
- ATL-HPA060198-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SMOX
Alternative Gene Name: C20orf16, dJ779E11.1, FLJ20746, MGC1010, PAO, PAOh1, SMO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027333: 94%, ENSRNOG00000021255: 93%
Entrez Gene ID: 54498
Uniprot ID: Q9NWM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVE |
Gene Sequence | HDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVE |
Gene ID - Mouse | ENSMUSG00000027333 |
Gene ID - Rat | ENSRNOG00000021255 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SMOX pAb (ATL-HPA060198) | |
Datasheet | Anti SMOX pAb (ATL-HPA060198) Datasheet (External Link) |
Vendor Page | Anti SMOX pAb (ATL-HPA060198) at Atlas Antibodies |
Documents & Links for Anti SMOX pAb (ATL-HPA060198) | |
Datasheet | Anti SMOX pAb (ATL-HPA060198) Datasheet (External Link) |
Vendor Page | Anti SMOX pAb (ATL-HPA060198) |
Citations for Anti SMOX pAb (ATL-HPA060198) – 1 Found |
Tepper, Armand W J W; Chu, Gerald; Klaren, Vincent N A; Kalin, Jay H; Molina-Ortiz, Patricia; Impagliazzo, Antonietta. Development and characterization of rabbit monoclonal antibodies that recognize human spermine oxidase and application to immunohistochemistry of human cancer tissues. Plos One. 17(4):e0267046. PubMed |