Protein Description: small lysine-rich protein 1
Gene Name: SMKR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 30%, ENSRNOG00000060410: 30%
Entrez Gene ID: 100287482
Uniprot ID: H3BMG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMKR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 30%, ENSRNOG00000060410: 30%
Entrez Gene ID: 100287482
Uniprot ID: H3BMG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK |
Documents & Links for Anti SMKR1 pAb (ATL-HPA078358) | |
Datasheet | Anti SMKR1 pAb (ATL-HPA078358) Datasheet (External Link) |
Vendor Page | Anti SMKR1 pAb (ATL-HPA078358) at Atlas |
Documents & Links for Anti SMKR1 pAb (ATL-HPA078358) | |
Datasheet | Anti SMKR1 pAb (ATL-HPA078358) Datasheet (External Link) |
Vendor Page | Anti SMKR1 pAb (ATL-HPA078358) |