Anti SMKR1 pAb (ATL-HPA078358)

Catalog No:
ATL-HPA078358-25
$447.00
Protein Description: small lysine-rich protein 1
Gene Name: SMKR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051375: 30%, ENSRNOG00000060410: 30%
Entrez Gene ID: 100287482
Uniprot ID: H3BMG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK
Gene ID - Mouse ENSMUSG00000051375
Gene ID - Rat ENSMUSG00000051375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SMKR1 pAb (ATL-HPA078358)
Datasheet Anti SMKR1 pAb (ATL-HPA078358) Datasheet (External Link)
Vendor Page Anti SMKR1 pAb (ATL-HPA078358) at Atlas

Documents & Links for Anti SMKR1 pAb (ATL-HPA078358)
Datasheet Anti SMKR1 pAb (ATL-HPA078358) Datasheet (External Link)
Vendor Page Anti SMKR1 pAb (ATL-HPA078358)