Anti SMIM4 pAb (ATL-HPA047771)

Atlas Antibodies

SKU:
ATL-HPA047771-25
  • Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: small integral membrane protein 4
Gene Name: SMIM4
Alternative Gene Name: C3orf78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058351: 97%, ENSRNOG00000033508: 37%
Entrez Gene ID:
Uniprot ID: Q8WVI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKVRVGQETFYDVYRRKASERQYQRRLEDE
Gene Sequence IKVRVGQETFYDVYRRKASERQYQRRLEDE
Gene ID - Mouse ENSMUSG00000058351
Gene ID - Rat ENSRNOG00000033508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SMIM4 pAb (ATL-HPA047771)
Datasheet Anti SMIM4 pAb (ATL-HPA047771) Datasheet (External Link)
Vendor Page Anti SMIM4 pAb (ATL-HPA047771) at Atlas Antibodies

Documents & Links for Anti SMIM4 pAb (ATL-HPA047771)
Datasheet Anti SMIM4 pAb (ATL-HPA047771) Datasheet (External Link)
Vendor Page Anti SMIM4 pAb (ATL-HPA047771)