Protein Description: small integral membrane protein 22
Gene Name: SMIM22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096215: 57%, ENSRNOG00000042344: 53%
Entrez Gene ID: 440335
Uniprot ID: K7EJ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMIM22
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096215: 57%, ENSRNOG00000042344: 53%
Entrez Gene ID: 440335
Uniprot ID: K7EJ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VSTEELEATVQEVLGRLKSHQFFQSTWDTV |
Documents & Links for Anti SMIM22 pAb (ATL-HPA077331) | |
Datasheet | Anti SMIM22 pAb (ATL-HPA077331) Datasheet (External Link) |
Vendor Page | Anti SMIM22 pAb (ATL-HPA077331) at Atlas |
Documents & Links for Anti SMIM22 pAb (ATL-HPA077331) | |
Datasheet | Anti SMIM22 pAb (ATL-HPA077331) Datasheet (External Link) |
Vendor Page | Anti SMIM22 pAb (ATL-HPA077331) |