Anti SMIM12 pAb (ATL-HPA065331)

Atlas Antibodies

SKU: ATL-HPA065331-25

• 
• 
• 

Protein Description: small integral membrane protein 12
Gene Name: SMIM12
Alternative Gene Name: C1orf212, FLJ90372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042380: 95%, ENSRNOG00000014352: 97%
Entrez Gene ID: 113444
Uniprot ID: Q96EX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
• Gene Sequence: LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
• Gene ID - Mouse: ENSMUSG00000042380
• Gene ID - Rat: ENSRNOG00000014352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.