![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99599/179209/atl-hpa065331_anti-smim12-pab-atl-hpa065331_60871__67478.1681134855.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: small integral membrane protein 12
Gene Name: SMIM12
Alternative Gene Name: C1orf212, FLJ90372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042380: 95%, ENSRNOG00000014352: 97%
Entrez Gene ID: 113444
Uniprot ID: Q96EX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMIM12
Alternative Gene Name: C1orf212, FLJ90372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042380: 95%, ENSRNOG00000014352: 97%
Entrez Gene ID: 113444
Uniprot ID: Q96EX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN |
| Documents & Links for Anti SMIM12 pAb (ATL-HPA065331) | |
| Datasheet | Anti SMIM12 pAb (ATL-HPA065331) Datasheet (External Link) |
| Vendor Page | Anti SMIM12 pAb (ATL-HPA065331) at Atlas |
| Documents & Links for Anti SMIM12 pAb (ATL-HPA065331) | |
| Datasheet | Anti SMIM12 pAb (ATL-HPA065331) Datasheet (External Link) |
| Vendor Page | Anti SMIM12 pAb (ATL-HPA065331) |