Anti SMCO3 pAb (ATL-HPA047804)

Atlas Antibodies

SKU: ATL-HPA047804-25

• 

Protein Description: single-pass membrane protein with coiled-coil domains 3
Gene Name: SMCO3
Alternative Gene Name: C12orf69, LOC440087
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043298: 84%, ENSRNOG00000048722: 79%
Entrez Gene ID: 440087
Uniprot ID: A2RU48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGRRLASIEMKRDGTIKENCDLIIQAIMK
• Gene Sequence: MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGRRLASIEMKRDGTIKENCDLIIQAIMK
• Gene ID - Mouse: ENSMUSG00000043298
• Gene ID - Rat: ENSRNOG00000048722
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.