Anti SMAD7 pAb (ATL-HPA028897)

Atlas Antibodies

Catalog No.:
ATL-HPA028897-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: SMAD family member 7
Gene Name: SMAD7
Alternative Gene Name: MADH7, MADH8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025880: 99%, ENSRNOG00000018359: 99%
Entrez Gene ID: 4092
Uniprot ID: O15105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG
Gene Sequence EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG
Gene ID - Mouse ENSMUSG00000025880
Gene ID - Rat ENSRNOG00000018359
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMAD7 pAb (ATL-HPA028897)
Datasheet Anti SMAD7 pAb (ATL-HPA028897) Datasheet (External Link)
Vendor Page Anti SMAD7 pAb (ATL-HPA028897) at Atlas Antibodies

Documents & Links for Anti SMAD7 pAb (ATL-HPA028897)
Datasheet Anti SMAD7 pAb (ATL-HPA028897) Datasheet (External Link)
Vendor Page Anti SMAD7 pAb (ATL-HPA028897)
Citations for Anti SMAD7 pAb (ATL-HPA028897) – 2 Found
Kinchen, James; Chen, Hannah H; Parikh, Kaushal; Antanaviciute, Agne; Jagielowicz, Marta; Fawkner-Corbett, David; Ashley, Neil; Cubitt, Laura; Mellado-Gomez, Esther; Attar, Moustafa; Sharma, Eshita; Wills, Quin; Bowden, Rory; Richter, Felix C; Ahern, David; Puri, Kamal D; Henault, Jill; Gervais, Francois; Koohy, Hashem; Simmons, Alison. Structural Remodeling of the Human Colonic Mesenchyme in Inflammatory Bowel Disease. Cell. 2018;175(2):372-386.e17.  PubMed
Tian, Bing; Widen, Steven G; Yang, Jun; Wood, Thomas G; Kudlicki, Andrzej; Zhao, Yingxin; Brasier, Allan R. The NFκB subunit RELA is a master transcriptional regulator of the committed epithelial-mesenchymal transition in airway epithelial cells. The Journal Of Biological Chemistry. 2018;293(42):16528-16545.  PubMed