Anti SLX4IP pAb (ATL-HPA046372)

Atlas Antibodies

SKU: ATL-HPA046372-25

• 
• 

Protein Description: SLX4 interacting protein
Gene Name: SLX4IP
Alternative Gene Name: C20orf94, dJ1099D15.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027281: 69%, ENSRNOG00000007430: 72%
Entrez Gene ID: 128710
Uniprot ID: Q5VYV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR
• Gene Sequence: MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR
• Gene ID - Mouse: ENSMUSG00000027281
• Gene ID - Rat: ENSRNOG00000007430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLX4IP pAb (ATL-HPA046372) – 1 Found

Mangosh, Tawna L; Awadallah, Wisam N; Grabowska, Magdalena M; Taylor, Derek J. SLX4IP Promotes Telomere Maintenance in Androgen Receptor-Independent Castration-Resistant Prostate Cancer through ALT-like Telomeric PML Localization. Molecular Cancer Research : Mcr. 2021;19(2):301-316.