Anti SLX4 pAb (ATL-HPA049421)

Atlas Antibodies

SKU: ATL-HPA049421-25

• 

Protein Description: SLX4 structure-specific endonuclease subunit
Gene Name: SLX4
Alternative Gene Name: BTBD12, FANCP, KIAA1784, KIAA1987
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039738: 65%, ENSRNOG00000024445: 69%
Entrez Gene ID: 84464
Uniprot ID: Q8IY92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA
• Gene Sequence: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA
• Gene ID - Mouse: ENSMUSG00000039738
• Gene ID - Rat: ENSRNOG00000024445
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.