Anti SLX1A pAb (ATL-HPA047038)

Atlas Antibodies

SKU: ATL-HPA047038-25

• 
• 

Protein Description: SLX1 homolog A, structure-specific endonuclease subunit
Gene Name: SLX1A
Alternative Gene Name: GIYD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059772: 79%, ENSRNOG00000019369: 77%
Entrez Gene ID: 548593
Uniprot ID: Q9BQ83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
• Gene Sequence: PGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
• Gene ID - Mouse: ENSMUSG00000059772
• Gene ID - Rat: ENSRNOG00000019369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.