Anti SLURP1 pAb (ATL-HPA050967)

Atlas Antibodies

SKU: ATL-HPA050967-25

• 
• 

Protein Description: secreted LY6/PLAUR domain containing 1
Gene Name: SLURP1
Alternative Gene Name: ANUP, ARS, ArsB, LY6LS, MDM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022596: 68%, ENSRNOG00000005944: 69%
Entrez Gene ID: 57152
Uniprot ID: P55000
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
• Gene Sequence: KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
• Gene ID - Mouse: ENSMUSG00000022596
• Gene ID - Rat: ENSRNOG00000005944
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.