Anti SLF1 pAb (ATL-HPA054213)

Atlas Antibodies

SKU:
ATL-HPA054213-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SMC5-SMC6 complex localization factor 1
Gene Name: SLF1
Alternative Gene Name: ANKRD32, BRCTD1, BRCTx, DKFZp564C0469, DKFZp761C121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021597: 67%, ENSRNOG00000040279: 67%
Entrez Gene ID: 84250
Uniprot ID: Q9BQI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLP
Gene Sequence SWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLP
Gene ID - Mouse ENSMUSG00000021597
Gene ID - Rat ENSRNOG00000040279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLF1 pAb (ATL-HPA054213)
Datasheet Anti SLF1 pAb (ATL-HPA054213) Datasheet (External Link)
Vendor Page Anti SLF1 pAb (ATL-HPA054213) at Atlas Antibodies

Documents & Links for Anti SLF1 pAb (ATL-HPA054213)
Datasheet Anti SLF1 pAb (ATL-HPA054213) Datasheet (External Link)
Vendor Page Anti SLF1 pAb (ATL-HPA054213)