Anti SLCO6A1 pAb (ATL-HPA054126 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054126-25

• 

Protein Description: solute carrier organic anion transporter family, member 6A1
Gene Name: SLCO6A1
Alternative Gene Name: CT48, MGC26949, OATP6A1, OATPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026331: 61%, ENSRNOG00000019252: 63%
Entrez Gene ID: 133482
Uniprot ID: Q86UG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
• Gene Sequence: AGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
• Gene ID - Mouse: ENSMUSG00000026331
• Gene ID - Rat: ENSRNOG00000019252
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLCO6A1 pAb (ATL-HPA054126 w/enhanced validation) – 2 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. 

Patik, Izabel; Kovacsics, Daniella; Német, Orsolya; Gera, Melinda; Várady, György; Stieger, Bruno; Hagenbuch, Bruno; Szakács, Gergely; Özvegy-Laczka, Csilla. Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate. Biochemical Pharmacology. 2015;98(4):649-58.