Anti SLC9B2 pAb (ATL-HPA047008)

Atlas Antibodies

SKU: ATL-HPA047008-25

• 

Protein Description: solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2
Gene Name: SLC9B2
Alternative Gene Name: FLJ23984, NHA2, NHEDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037994: 54%, ENSRNOG00000023404: 46%
Entrez Gene ID: 133308
Uniprot ID: Q86UD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQR
• Gene Sequence: PSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQR
• Gene ID - Mouse: ENSMUSG00000037994
• Gene ID - Rat: ENSRNOG00000023404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.