Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066520-25
  • Immunohistochemistry analysis in human spleen and tonsil tissues using Anti-SLC9A3R2 antibody. Corresponding SLC9A3R2 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SLC9A3 regulator 2
Gene Name: SLC9A3R2
Alternative Gene Name: E3KARP, NHERF-2, SIP-1, TKA-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002504: 94%, ENSRNOG00000002997: 90%
Entrez Gene ID: 9351
Uniprot ID: Q15599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD
Gene Sequence ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD
Gene ID - Mouse ENSMUSG00000002504
Gene ID - Rat ENSRNOG00000002997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation)
Datasheet Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation)