Protein Description: SLC9A3 regulator 2
Gene Name: SLC9A3R2
Alternative Gene Name: E3KARP, NHERF-2, SIP-1, TKA-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002504: 94%, ENSRNOG00000002997: 90%
Entrez Gene ID: 9351
Uniprot ID: Q15599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC9A3R2
Alternative Gene Name: E3KARP, NHERF-2, SIP-1, TKA-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002504: 94%, ENSRNOG00000002997: 90%
Entrez Gene ID: 9351
Uniprot ID: Q15599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD |
Documents & Links for Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) | |
Datasheet | Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) at Atlas |
Documents & Links for Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) | |
Datasheet | Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLC9A3R2 pAb (ATL-HPA066520 w/enhanced validation) |