Anti SLC9A1 pAb (ATL-HPA052891 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052891-25

• 
• 

Protein Description: solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Gene Name: SLC9A1
Alternative Gene Name: APNH, NHE1, PPP1R143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028854: 83%, ENSRNOG00000007982: 83%
Entrez Gene ID: 6548
Uniprot ID: P19634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG
• Gene Sequence: SPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG
• Gene ID - Mouse: ENSMUSG00000028854
• Gene ID - Rat: ENSRNOG00000007982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.