Anti SLC7A8 pAb (ATL-HPA060672 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060672-25

• 

Protein Description: solute carrier family 7 (amino acid transporter light chain, L system), member 8
Gene Name: SLC7A8
Alternative Gene Name: LAT2, LPI-PC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022180: 74%, ENSRNOG00000014311: 79%
Entrez Gene ID: 23428
Uniprot ID: Q9UHI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
• Gene Sequence: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
• Gene ID - Mouse: ENSMUSG00000022180
• Gene ID - Rat: ENSRNOG00000014311
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.