Anti SLC7A14 pAb (ATL-HPA045929)

Atlas Antibodies

SKU: ATL-HPA045929-25

• 

Protein Description: solute carrier family 7, member 14
Gene Name: SLC7A14
Alternative Gene Name: KIAA1613, PPP1R142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069072: 95%, ENSRNOG00000028097: 95%
Entrez Gene ID: 57709
Uniprot ID: Q8TBB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRL
• Gene Sequence: ADCEKEACSPVSEGDEFSGPATNTCGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPHYYTMRIRL
• Gene ID - Mouse: ENSMUSG00000069072
• Gene ID - Rat: ENSRNOG00000028097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC7A14 pAb (ATL-HPA045929) – 3 Found

Li, Yi; Liu, Huizhan; Giffen, Kimberlee P; Chen, Lei; Beisel, Kirk W; He, David Z Z. Transcriptomes of cochlear inner and outer hair cells from adult mice. Scientific Data. 2018;5( 30277483):180199. 

Jin, Zi-Bing; Huang, Xiu-Feng; Lv, Ji-Neng; Xiang, Lue; Li, Dong-Qing; Chen, Jiangfei; Huang, Changjiang; Wu, Jinyu; Lu, Fan; Qu, Jia. SLC7A14 linked to autosomal recessive retinitis pigmentosa. Nature Communications. 2014;5( 24670872):3517. 

Liu, Huizhan; Giffen, Kimberlee P; Chen, Lei; Henderson, Heidi J; Cao, Talia A; Kozeny, Grant A; Beisel, Kirk W; Li, Yi; He, David Z. Molecular and cytological profiling of biological aging of mouse cochlear inner and outer hair cells. Cell Reports. 2022;39(2):110665.