Anti SLC5A5 pAb (ATL-HPA049055 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049055-25
  • Immunohistochemistry analysis in human salivary gland and placenta tissues using HPA049055 antibody. Corresponding SLC5A5 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 5 (sodium/iodide cotransporter), member 5
Gene Name: SLC5A5
Alternative Gene Name: NIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000792: 48%, ENSRNOG00000018822: 47%
Entrez Gene ID: 6528
Uniprot ID: Q92911
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Gene Sequence PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Gene ID - Mouse ENSMUSG00000000792
Gene ID - Rat ENSRNOG00000018822
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC5A5 pAb (ATL-HPA049055 w/enhanced validation)
Datasheet Anti SLC5A5 pAb (ATL-HPA049055 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC5A5 pAb (ATL-HPA049055 w/enhanced validation)