Anti SLC5A10 pAb (ATL-HPA052014)

Atlas Antibodies

SKU: ATL-HPA052014-25

• 

Protein Description: solute carrier family 5 (sodium/sugar cotransporter), member 10
Gene Name: SLC5A10
Alternative Gene Name: SGLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042371: 77%, ENSRNOG00000002616: 70%
Entrez Gene ID: 125206
Uniprot ID: A0PJK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQSVQIENLTWWTLAQDVPLGTKAGDGQTP
• Gene Sequence: PQSVQIENLTWWTLAQDVPLGTKAGDGQTP
• Gene ID - Mouse: ENSMUSG00000042371
• Gene ID - Rat: ENSRNOG00000002616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.