Anti SLC5A1 pAb (ATL-HPA055106 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055106-25

• 
• 

Protein Description: solute carrier family 5 (sodium/glucose cotransporter), member 1
Gene Name: SLC5A1
Alternative Gene Name: D22S675, NAGT, SGLT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011034: 76%, ENSRNOG00000017775: 79%
Entrez Gene ID: 6523
Uniprot ID: P13866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRAD
• Gene Sequence: HEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRAD
• Gene ID - Mouse: ENSMUSG00000011034
• Gene ID - Rat: ENSRNOG00000017775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.