Anti SLC52A3 pAb (ATL-HPA049391)

Atlas Antibodies

SKU: ATL-HPA049391-25

• 

Protein Description: solute carrier family 52 (riboflavin transporter), member 3
Gene Name: SLC52A3
Alternative Gene Name: bA371L19.1, C20orf54, hRFT2, RFVT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027463: 50%, ENSRNOG00000005132: 50%
Entrez Gene ID: 113278
Uniprot ID: Q9NQ40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKA
• Gene Sequence: RQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKA
• Gene ID - Mouse: ENSMUSG00000027463
• Gene ID - Rat: ENSRNOG00000005132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.