Anti SLC52A3 pAb (ATL-HPA049391)
Atlas Antibodies
- SKU:
- ATL-HPA049391-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC52A3
Alternative Gene Name: bA371L19.1, C20orf54, hRFT2, RFVT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027463: 50%, ENSRNOG00000005132: 50%
Entrez Gene ID: 113278
Uniprot ID: Q9NQ40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKA |
Gene Sequence | RQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKA |
Gene ID - Mouse | ENSMUSG00000027463 |
Gene ID - Rat | ENSRNOG00000005132 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC52A3 pAb (ATL-HPA049391) | |
Datasheet | Anti SLC52A3 pAb (ATL-HPA049391) Datasheet (External Link) |
Vendor Page | Anti SLC52A3 pAb (ATL-HPA049391) at Atlas Antibodies |
Documents & Links for Anti SLC52A3 pAb (ATL-HPA049391) | |
Datasheet | Anti SLC52A3 pAb (ATL-HPA049391) Datasheet (External Link) |
Vendor Page | Anti SLC52A3 pAb (ATL-HPA049391) |