Anti SLC51A pAb (ATL-HPA045488 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045488-25

• 

Protein Description: solute carrier family 51 alpha subunit
Gene Name: SLC51A
Alternative Gene Name: OSTalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035699: 83%, ENSRNOG00000001765: 81%
Entrez Gene ID: 200931
Uniprot ID: Q86UW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP
• Gene Sequence: MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP
• Gene ID - Mouse: ENSMUSG00000035699
• Gene ID - Rat: ENSRNOG00000001765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.