Anti SLC4A9 pAb (ATL-HPA051307)

Atlas Antibodies

SKU: ATL-HPA051307-25

• 

Protein Description: solute carrier family 4, sodium bicarbonate cotransporter, member 9
Gene Name: SLC4A9
Alternative Gene Name: AE4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024485: 70%, ENSRNOG00000018525: 70%
Entrez Gene ID: 83697
Uniprot ID: Q96Q91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQHYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNP
• Gene Sequence: LVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQHYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNP
• Gene ID - Mouse: ENSMUSG00000024485
• Gene ID - Rat: ENSRNOG00000018525
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.