Protein Description: solute carrier family 4 member 8
Gene Name: SLC4A8
Alternative Gene Name: NBC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023032: 98%, ENSRNOG00000028879: 97%
Entrez Gene ID: 9498
Uniprot ID: Q2Y0W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC4A8
Alternative Gene Name: NBC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023032: 98%, ENSRNOG00000028879: 97%
Entrez Gene ID: 9498
Uniprot ID: Q2Y0W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRV |
| Documents & Links for Anti SLC4A8 pAb (ATL-HPA077895) | |
| Datasheet | Anti SLC4A8 pAb (ATL-HPA077895) Datasheet (External Link) |
| Vendor Page | Anti SLC4A8 pAb (ATL-HPA077895) at Atlas |
| Documents & Links for Anti SLC4A8 pAb (ATL-HPA077895) | |
| Datasheet | Anti SLC4A8 pAb (ATL-HPA077895) Datasheet (External Link) |
| Vendor Page | Anti SLC4A8 pAb (ATL-HPA077895) |