Protein Description: solute carrier family 4 member 4
Gene Name: SLC4A4
Alternative Gene Name: hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060961: 98%, ENSRNOG00000003134: 98%
Entrez Gene ID: 8671
Uniprot ID: Q9Y6R1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC4A4
Alternative Gene Name: hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060961: 98%, ENSRNOG00000003134: 98%
Entrez Gene ID: 8671
Uniprot ID: Q9Y6R1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKF |
| Documents & Links for Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) | |
| Datasheet | Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) | |
| Datasheet | Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) |