Anti SLC44A5 pAb (ATL-HPA047455)

Atlas Antibodies

SKU: ATL-HPA047455-25

• 
• 

Protein Description: solute carrier family 44, member 5
Gene Name: SLC44A5
Alternative Gene Name: CTL5, MGC34032
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028360: 57%, ENSRNOG00000042332: 59%
Entrez Gene ID: 204962
Uniprot ID: Q8NCS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYAR
• Gene Sequence: DDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYAR
• Gene ID - Mouse: ENSMUSG00000028360
• Gene ID - Rat: ENSRNOG00000042332
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.