Anti SLC44A4 pAb (ATL-HPA046977 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046977-25

• 

Protein Description: solute carrier family 44, member 4
Gene Name: SLC44A4
Alternative Gene Name: C6orf29, CTL4, FLJ14491, NG22, TPPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007034: 75%, ENSRNOG00000000878: 71%
Entrez Gene ID: 80736
Uniprot ID: Q53GD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGV
• Gene Sequence: RQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGV
• Gene ID - Mouse: ENSMUSG00000007034
• Gene ID - Rat: ENSRNOG00000000878
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.