Anti SLC44A3 pAb (ATL-HPA047433 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047433-25

• 
• 

Protein Description: solute carrier family 44, member 3
Gene Name: SLC44A3
Alternative Gene Name: CTL3, MGC45474
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039865: 86%, ENSRNOG00000011723: 84%
Entrez Gene ID: 126969
Uniprot ID: Q8N4M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQ
• Gene Sequence: GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQ
• Gene ID - Mouse: ENSMUSG00000039865
• Gene ID - Rat: ENSRNOG00000011723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.