Protein Description: solute carrier family 40 (iron-regulated transporter), member 1
Gene Name: SLC40A1
Alternative Gene Name: FPN1, HFE4, IREG1, MTP1, SLC11A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025993: 87%, ENSRNOG00000049995: 86%
Entrez Gene ID: 30061
Uniprot ID: Q9NP59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC40A1
Alternative Gene Name: FPN1, HFE4, IREG1, MTP1, SLC11A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025993: 87%, ENSRNOG00000049995: 86%
Entrez Gene ID: 30061
Uniprot ID: Q9NP59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYN |
| Documents & Links for Anti SLC40A1 pAb (ATL-HPA065634) | |
| Datasheet | Anti SLC40A1 pAb (ATL-HPA065634) Datasheet (External Link) |
| Vendor Page | Anti SLC40A1 pAb (ATL-HPA065634) at Atlas |
| Documents & Links for Anti SLC40A1 pAb (ATL-HPA065634) | |
| Datasheet | Anti SLC40A1 pAb (ATL-HPA065634) Datasheet (External Link) |
| Vendor Page | Anti SLC40A1 pAb (ATL-HPA065634) |
| Citations for Anti SLC40A1 pAb (ATL-HPA065634) – 1 Found |
| Sato, Masanori; Miyanishi, Koji; Tanaka, Shingo; Sakurada, Akira; Sakamoto, Hiroki; Kawano, Yutaka; Takada, Kohichi; Kobune, Masayoshi; Kato, Junji. Increased Duodenal Iron Absorption through Upregulation of Ferroportin 1 due to the Decrement in Serum Hepcidin in Patients with Chronic Hepatitis C. Canadian Journal Of Gastroenterology & Hepatology. 2018( 30186818):2154361. PubMed |