Protein Description: solute carrier family 39 (zinc transporter), member 10
Gene Name: SLC39A10
Alternative Gene Name: DKFZp564L2123, FLJ90515, KIAA1265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025986: 89%, ENSRNOG00000011677: 89%
Entrez Gene ID: 57181
Uniprot ID: Q9ULF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC39A10
Alternative Gene Name: DKFZp564L2123, FLJ90515, KIAA1265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025986: 89%, ENSRNOG00000011677: 89%
Entrez Gene ID: 57181
Uniprot ID: Q9ULF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTK |
Documents & Links for Anti SLC39A10 pAb (ATL-HPA066087) | |
Datasheet | Anti SLC39A10 pAb (ATL-HPA066087) Datasheet (External Link) |
Vendor Page | Anti SLC39A10 pAb (ATL-HPA066087) at Atlas |
Documents & Links for Anti SLC39A10 pAb (ATL-HPA066087) | |
Datasheet | Anti SLC39A10 pAb (ATL-HPA066087) Datasheet (External Link) |
Vendor Page | Anti SLC39A10 pAb (ATL-HPA066087) |
Citations for Anti SLC39A10 pAb (ATL-HPA066087) – 1 Found |
Yang, Andrew C; Vest, Ryan T; Kern, Fabian; Lee, Davis P; Agam, Maayan; Maat, Christina A; Losada, Patricia M; Chen, Michelle B; Schaum, Nicholas; Khoury, Nathalie; Toland, Angus; Calcuttawala, Kruti; Shin, Heather; Pálovics, Róbert; Shin, Andrew; Wang, Elizabeth Y; Luo, Jian; Gate, David; Schulz-Schaeffer, Walter J; Chu, Pauline; Siegenthaler, Julie A; McNerney, M Windy; Keller, Andreas; Wyss-Coray, Tony. A human brain vascular atlas reveals diverse mediators of Alzheimer's risk. Nature. 2022;603(7903):885-892. PubMed |