Anti SLC38A5 pAb (ATL-HPA047411 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047411-25

• 
• 

Protein Description: solute carrier family 38, member 5
Gene Name: SLC38A5
Alternative Gene Name: JM24, SN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031170: 70%, ENSRNOG00000027767: 72%
Entrez Gene ID: 92745
Uniprot ID: Q8WUX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFE
• Gene Sequence: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFE
• Gene ID - Mouse: ENSMUSG00000031170
• Gene ID - Rat: ENSRNOG00000027767
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.