Anti SLC35F3 pAb (ATL-HPA061582)

Atlas Antibodies

SKU: ATL-HPA061582-25

• 

Protein Description: solute carrier family 35, member F3
Gene Name: SLC35F3
Alternative Gene Name: FLJ37712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057060: 80%, ENSRNOG00000049456: 80%
Entrez Gene ID: 148641
Uniprot ID: Q8IY50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARP
• Gene Sequence: WDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARP
• Gene ID - Mouse: ENSMUSG00000057060
• Gene ID - Rat: ENSRNOG00000049456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.