Anti SLC35F2 pAb (ATL-HPA050695)

Atlas Antibodies

SKU: ATL-HPA050695-100

• 
• 

Protein Description: solute carrier family 35, member F2
Gene Name: SLC35F2
Alternative Gene Name: FLJ13018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042195: 55%, ENSRNOG00000009014: 55%
Entrez Gene ID: 54733
Uniprot ID: Q8IXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN
• Gene Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN
• Gene ID - Mouse: ENSMUSG00000042195
• Gene ID - Rat: ENSRNOG00000009014
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.