Anti SLC35C2 pAb (ATL-HPA027011)

Atlas Antibodies

SKU: ATL-HPA027011-25

• 
• 

Protein Description: solute carrier family 35 (GDP-fucose transporter), member C2
Gene Name: SLC35C2
Alternative Gene Name: bA394O2.1, C20orf5, CGI-15, OVCOV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017664: 83%, ENSRNOG00000018649: 80%
Entrez Gene ID: 51006
Uniprot ID: Q9NQQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
• Gene Sequence: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
• Gene ID - Mouse: ENSMUSG00000017664
• Gene ID - Rat: ENSRNOG00000018649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.